For research use only. Not for human consumption. Not medical advice — consult a licensed clinician.

Growth Hormone Secretagogues

Follistatin 344

Also known as: FS-344

Follistatin 344 is a recombinant form of the naturally-occurring glycoprotein (344-residue splice variant) that inhibits activin and myostatin signaling. Clinical validation exists ONLY through small AAV gene-therapy phase 1/2 trials in Becker muscular dystrophy; recombinant injectable protein sold on the grey market has no clinical evidence. NOT FDA-approved. WADA-prohibited (myostatin inhibitor) and banned in competitive sport.

Where to buy · live market data

Who's worth your money for Follistatin 344

Every current seller, ranked by independent evidence — Merit Score, latest COA purity, and live $/mg (size-normalized). Prices refresh daily. Rankings are never paid.

Top Merit pick

Highest Merit Score (89) of 3 scored sellers

$161.99/mg

$162 · 1mg · 99.5% purity

Best value

Lowest $/mg among scored sellers

$32.10/mg

$321 · 10mg

no COAs yet

Average price

$123.73/mg

Sellers

9

45-day trend

+12.4%

8 of 9 sellers have a current price· 1 stale hidden· 4 unverified hidden

Prices observed from public storefronts (last 24h), normalized to $/mg. "Evidence" is Merit's 0–100 Merit Score, derived only from observable verification evidence (methodology on /about); "Purity" is the latest independent COA. Some buy links are affiliate links — Merit may earn a commission at no extra cost to you, and where a vendor offers one, the code shown gets you a discount at their checkout. Affiliate status never affects price data, ranking, or the Merit Score (full policy on /disclosure). Research use only.

Watch Follistatin 344

Get one email when the market actually moves — no newsletter, no noise.

Compound reference

About Follistatin 344

CAS

Molecular formula

Sequence

MVRARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW

Typical dose range

100–200 mcg/day subcutaneous (research use; cycles of 10–30 days on, 3–4 weeks off)

Half-life

~90 minutes (recombinant injectable form); endogenous FST-315 isoform estimated ~10–15 hours

Research depth

12 citations indexed for Follistatin 344

All research on Follistatin 344 →

review · 2026

Safety and Efficacy of Approved and Unapproved Peptide Therapies for Musculoskeletal Injuries and Athletic Performance

Peptides are short chains of amino acids with a unique pharmacological niche between small-molecule drugs and large proteins. Their use in sports medicine is rapidly expanding, driven by patient demand for accelerated injury recovery and performance enhancement.

review · 2026

Therapeutic Peptides in Aesthetic, Metabolic and Endocrine Conditions: Effects, Safety, Clinical Applications, and Future Perspectives

Therapeutic peptides are short chains of amino acids used to treat metabolic and endocrine conditions such as obesity and type 2 diabetes.

Study · 2026

Grip strength as a systems biomarker of aging: neuromuscular junction constraints and biomarker decoupling in gene therapy

Grip strength has emerged as one of the most robust predictors of mortality, disability and healthspan across populations.

review · 2026

Myostatin Research: From Molecular Understanding to Clinical Translation for Musculoskeletal and Metabolic Disorders

Myostatin (Mstn), a well-characterized member of the transforming growth factor-β (TGF-β) superfamily, serves as a key negative regulator of skeletal muscle mass. Its overactivation is closely associated with the pathogenesis of various musculoskeletal and metabolic disorders.

Study · 2025

Gel Electrophoretic Detection of Black Market ACE-031

The usage of ACE-031 (Ramatercept), a dimeric fusion protein consisting of a human activin receptor IIB (ACVR2B) fragment linked to an Fc-part of human IgG1, is banned according to chapter S4.3 of the "WADA 2024 List of Prohibited Substances and Methods" due to its potential performance enhancing properties.

review · 2023

The elusive role of myostatin signaling for muscle regeneration and maintenance of muscle and bone homeostasis

Skeletal muscle is one of the leading frameworks of the musculo-skeletal system, which works in synergy with the bones. Long skeletal muscles provide stability and mobility to the human body and are primarily composed of proteins.